SAB2108783

Anti-SIM1 antibody produced in rabbit biotin conjugated

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.45

속성

• 생물학적 소스: rabbit
• 결합: biotin conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 85 kDa
• 종 반응성(상동성에 의해 예측): mouse, guinea pig, canine, rabbit, bovine, pig, horse, human
• 농도: 0.5 mg/mL
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• NCBI 수납 번호: NM_005068
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SIM1(6492)

설명

일반 설명

SIM1 and SIM2 genes are Drosophila single-minded (sim) gene homologs. SIM1 transcript was detected only in fetal kidney out of various adult and fetal tissues tested. Since the sim gene plays an important role in Drosophila development and has peak levels of expression during the period of neurogenesis,it was proposed that the human SIM gene is a candidate for involvement in certain dysmorphic features (particularly the facial and skull characteristics), abnormalities of brain development, and/or mental retardation of Down syndrome.

면역원

Synthetic peptide directed towards the middle region of Human SIM1

서열

Synthetic peptide located within the following region: SSSKSKSRTSPYPQYSGFHTERSESDHDSQWGGSPLTDTASPQLLDPADR

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable