추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
54 kDa
종 반응성
human
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
수납 번호(accession number)
NM_152649
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MLKL(197259)
일반 설명
Mixed lineage kinase domain-like protein (MLKL) is encoded by the gene mapped to human chromosome 16q23. Activated MLKL is localized on the cell membrane.
면역원
Synthetic peptide directed towards the N terminal region of human MLKL
생화학적/생리학적 작용
Mixed lineage kinase domain-like protein (MLKL) primarily causes receptor-interacting protein (RIP) kinase–dependent necroptosis. However, during hepatitis, it results in programmed hepatocellular necrosis which is independent of RIPK3.s MLKL also participates in endosomal trafficking and in the formation of extracellular vesicles.
서열
Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Genetic changes associated with testicular cancer susceptibility.
Pyle LC and Nathanson KL
Seminars in Oncology, 43, 575-575 (2016)
The pseudokinase MLKL mediates programmed hepatocellular necrosis independently of RIPK3 during hepatitis.
Gunther C
The Journal of Clinical Investigation, 126, 4346-4346 (2016)
MLKL, the Protein that Mediates Necroptosis, Also Regulates Endosomal Trafficking and Extracellular Vesicle Generation.
Yoon S
Immunity, 47, 51-51 (2017)
MLKL Activation Triggers NLRP3-Mediated Processing and Release of IL-1? Independently of Gasdermin-D.
Gutierrez KD
Journal of Immunology, 198, 2156-2156 (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.