생물학적 소스
rabbit
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
21 kDa
종 반응성
bovine, human, dog, pig
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
immunohistochemistry: suitable
수납 번호(accession number)
NM_138761
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... BAX(581)
일반 설명
B-cell lymphoma 2 associated X (BAX), also known as CLECSF10 (C-type lectin superfamily member 10), is located on human chromosome 19q13. BAX is a proapoptotic protein and is a member of Bcl-2 protein family.
면역원
Synthetic peptide directed towards the N terminal region of human BAX
애플리케이션
Anti-BAX has been used in Western blotting.
생화학적/생리학적 작용
B-cell lymphoma 2 associated X (BAX) promotes cell death and plays a vital role in regulation of apoptosis. BAX gene may act as a negative regulator of autophagy in CRC (colorectal cancer) development.
서열
Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Enhanced radiation effect on SMCC7721 cells through endoplasmic reticulum stress induced by C225-GNPs in vitro and in vivo
Zhu C, et al.
Oncology Letters, 15, 4221-4228 (2018)
Cytoprotective Peptide Humanin Binds and Inhibits Proapoptotic Bcl-2/Bax Family Protein BimEL
Luciano F, et al.
The Journal of Biological Chemistry, 280, 15825-15835 (2005)
Immediate early up-regulation of bax expression by p53 but not TGF beta 1: a paradigm for distinct apoptotic pathways.
Selvakumaran M, et al.
Oncogene, 9, 1791-1798 (1994)
The BAX gene as a candidate for negative autophagy-related genes regulator on mRNA levels in colorectal cancer
Gil J, et al.
Medical Oncology (Northwood, London, England), 34 (2017)
The substitution of Proline 168 favors Bax oligomerization and stimulates its interaction with LUVs and mitochondria.
Simonyan L, et al.
Biochimica et Biophysica Acta, 1859, 1144-1155 (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.