콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

SAB2101136

Sigma-Aldrich

Anti-IGF1R antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-CD221, Anti-IGFIR, Anti-Insulin-like growth factor 1 receptor, Anti-JTK13, Anti-MGC142170

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

71 kDa

종 반응성

pig, horse, sheep, bovine, dog, human

농도

0.5 mg - 1 mg/mL

기술

immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... IGF1R(3480)

일반 설명

Insulin-like growth factor 1 receptor (IGF1R), a transmembrane tyrosine kinase receptor, belongs to the insulin receptor family. It comprises juxtamembrane (JM) and transmembrane domains that harbor substrate binding sites. Structurally, IGF1R exists as a tetramer α2/β2 with the extracellular dimeric α subunits. The IGF1R gene is mapped to human chromosome 15q26.3.

면역원

Synthetic peptide directed towards the middle region of human IGF1R

생화학적/생리학적 작용

Insulin-like growth factor 1 receptor (IGF1R) is prime for IGF-1 for its mitogenic and metabolic functionality. It binds to IGF1 and IGF2 and activates phosphatidylinositol 3?kinase (PI3K)/protein kinase B (AKT) and mitogen-activated protein kinase pathways. IGF1R plays a key role in growth, differentiation, cell metabolic events, and apoptosis. It also favors proliferation in the myelodysplastic syndrome (MDS) and may serve as a potential target to treat MDS. Mutations in the IGF1R gene are implicated in the pre- and postnatal growth retardation and microcephaly. High levels of IGF1R overexpression are observed in multiple myeloma, lung, breast, bladder and pancreatic tumors.

서열

Synthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Andrey S Kuznetsov et al.
Biochimica et biophysica acta. Biomembranes, 1862(11), 183417-183417 (2020-07-28)
Despite the biological significance of insulin signaling, the molecular mechanisms of activation of the insulin receptor (IR) and other proteins from its family remain elusive. Current hypothesis on signal transduction suggests ligand-triggered structural changes in the extracellular domain followed by
Nilda Gonzalez-Roibon et al.
Urology, 83(6), 1444-1444 (2014-04-10)
To assess the insulin-like growth factor-1 receptor (IGF1R) expression in urothelial carcinoma (UC) and its prognostic role in relation to clinicopathologic parameters. A total of 100 cases of invasive UC were evaluated using tissue microarrays. Membranous IGF1R staining was evaluated
Anja Runge et al.
Cancer research, 74(15), 4157-4169 (2014-06-08)
The limited availability of experimental tumor models that faithfully mimic the progression of human tumors and their response to therapy remains a major bottleneck to the clinical translation and application of novel therapeutic principles. To address this challenge in hepatocellular
Matias Juanes et al.
Clinical endocrinology, 82(5), 704-711 (2014-07-22)
IGF1R gene mutations have been associated with varying degrees of intrauterine and postnatal growth retardation, and microcephaly. To identify and characterize IGF1R gene variations in a cohort of 28 Argentinean children suspected of having IGF-1 insensitivity, who were selected on
Utku Donem Dilli et al.
Asian Pacific journal of cancer prevention : APJCP, 15(14), 5753-5757 (2014-08-02)
The purpose of this study is to determine whether the IGF1R expression has a prognostic role in non-small cell lung cancer. Forty-seven patients histopathologically diagnosed with small cell lung cancer upon bronchoscopic biopsy or resection materials were included in the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.