WH0057167M3

Monoclonal Anti-SALL4 antibody produced in mouse

clone 6E3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-DRRS, Anti-HSAL4, Anti-MGC133050, Anti-dJ1112F19.1, Anti-sal-like 4 (Drosophila)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6E3, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human, mouse, rat
• 기술: ELISA: suitable; capture ELISA: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: NM_020436
• UniProt 수납 번호: Q9UJQ4
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SALL4(57167)

설명

일반 설명

Spalt like transcription factor 4 (SALL4) is encoded by the gene with four exons, mapped to human chromosome 20q13.13-q13.2. The encoded protein belongs to the spalt-like protein family. SALL4 is characterized with a multiple zinc finger (ZnF) domains including one N-terminal C2HC-type ZnF and seven C2H2-type ZnF domains. In vertebrates, SALL4 is abundantly expressed in both embryonic and adult stem/stem-like cells.

The protein encoded by this gene may be a zinc finger transcription factor. Defects in this gene are a cause of Duane-radial ray syndrome (DRRS). (provided by RefSeq)

면역원

SALL4 (NP_065169, 954 a.a. ~ 1053 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKEILAPSVNVDPVVWNQYTSMLNGGLAVKTNEISVIQSGGVPTLPVSLGATSVVNNATVSKMDGSQSGISADVEKPSATDGVPKHQFPHFLEENKIAVS

애플리케이션

Monoclonal Anti-SALL4 antibody produced in mouse has been used in immunohistochemical staining.

생화학적/생리학적 작용

Spalt like transcription factor 4 (SALL4) plays a crucial role in the regulation of cell stemness in biological development and tumor growth. Thus, this protein can be considered as a potent target for gene therapy. In addition, it also serves as a potential diagnostic marker for testicular germ cell tumors (GCTs). Polymorphisms in the gene are associated with the development of various diseases such as Duane-radial ray syndrome (DRRS, Okihiro syndrome), acro-renal-ocular syndrome (AROS), and SALL4-related Holt-Oram syndrome (HOS).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)