추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4G4, monoclonal
형태
buffered aqueous solution
분자량
antigen 36.63 kDa
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SREBF1(6720)
일반 설명
Sterol regulatory element binding transcription factor 1 (SREBF1) gene is located on human chromosome 17p11.2. SREBF1 encodes the transcription factors SREBP-1a and SREBP-1c. SREBP-1a is expressed in spleen and intestine.SREBP-1c is expressed in liver, adipose tissue and skeletal muscle.
면역원
SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
생화학적/생리학적 작용
Sterol regulatory element binding transcription factor 1 (SREBF1) regulates lipogenesis, energy homeostasis and insulin sensitivity. It is associated with non-alcoholic fatty liver disease (NAFLD). SREBF1 promotes tumor growth in various cancers. SREBF1 acts as a molecular bridge between lipogenesis and cell cycle control clear cell renal carcinoma.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
54G/C polymorphism of SREBF-1 gene is associated with polycystic ovary syndrome
Li L, et al.
European Journal of Obstetrics, Gynecology, and Reproductive Biology, 188, 95-99 (2015)
SREBP-1c as a molecular bridge between lipogenesis and cell cycle progression of clear cell renal carcinoma
Sethi G, et al.
Bioscience Reports, BSR20171270-BSR20171270 (2017)
Association of variants in the sterol regulatory element-binding factor 1 gene (SREBF1) with type 2 diabetes, glycemia, and insulin resistance-A study of 15,734 Danish subjects
Grarup MDN, et al.
Diabetes (2008)
Lack of association between SREBF-1c gene polymorphisms and risk of non-alcoholic fatty liver disease in a Chinese Han population
Peng XE, et al.
Scientific reports, 6, 32110-32110 (2016)
Structure of the human gene encoding sterol regulatory element binding protein-1 (SREBF1) and localization of SREBF1 and SREBF2 to chromosomes 17p11. 2 and 22q13.
Hua X, et al.
Genomics, 25(3), 667-673 (1995)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.