추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
124 kDa
종 반응성
rat, guinea pig, dog, human, bovine, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SREBF2(6721)
면역원
Synthetic peptide directed towards the middle region of human SREBF2
애플리케이션
Anti- SREBF2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
생화학적/생리학적 작용
Sterol Regulatory Element-Binding Proteins (SREBPs) are transcription factors that are required for metabolic reprogramming and membrane synthesis in CD8+ T cells during the transition from quiescence to activation. SREBF2 is a transcriptional regulator of genes involved in cholesterol biosynthesis and lipid homeostasis.
서열
Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Guido T Bommer et al.
Cell metabolism, 13(3), 241-247 (2011-03-02)
The sterol regulatory element-binding factor-2 (SREBF2) gene is a bifunctional locus encoding SREBP-2, a well-known transcriptional regulator of genes involved in cholesterol biosynthesis, and microRNA-33a, which has recently been shown to reduce expression of proteins involved in export of cholesterol
Yoko Kidani et al.
Nature immunology, 14(5), 489-499 (2013-04-09)
Newly activated CD8(+) T cells reprogram their metabolism to meet the extraordinary biosynthetic demands of clonal expansion; however, the signals that mediate metabolic reprogramming remain poorly defined. Here we demonstrate an essential role for sterol regulatory element-binding proteins (SREBPs) in
Veerle W Daniëls et al.
PloS one, 9(9), e106913-e106913 (2014-09-13)
Increased lipogenesis is a hallmark of a wide variety of cancers and is under intense investigation as potential antineoplastic target. Although brisk lipogenesis is observed in the presence of exogenous lipids, evidence is mounting that these lipids may adversely affect
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.