추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4D3, monoclonal
양식
buffered aqueous solution
분자량
antigen 37.4 kDa
종 반응성
, human,
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TBX18(9096)
일반 설명
T-box transcription factor 18 (TBX18) belongs to the TBX family of transcription factors. It contains a conserved T-box domain and an N-terminal nuclear localization signal (NLS). The TBX18 gene is mapped to human chromosome 6q14.3
면역원
TBX18 (XP_496819, 454 a.a. ~ 560 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
Sequence
STLLQGTGNGVPATHPHLLSGSSCSSPAFHLGPNTSQLCSLAPADYSACARSGLTLNRYSTSLAETYNRLTNQAGETFAPPRTPSYVGVSSSTSVNMSMGGTDGDTF
애플리케이션
ANTI-TBX18 antibody produced in mouse has been used in immunofluorescence staining.
생화학적/생리학적 작용
T-box transcription factor 18 (TBX18) is involved in the sinoatrial node (SAN) formation and is expressed in the development and differentiation stages. It is a crucial factor for the pacemaker cell formation from cardiomyocytes. TBX18 may be implicated in congenital heart defects and congenital anomalies of the kidneys and urinary tract (CAKUT).
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
NODAL inhibition promotes differentiation of pacemaker-like cardiomyocytes from human induced pluripotent stem cells
Yechikov S, et al.
Stem Cell Research (2021)
Soumya Negi et al.
Developmental biology, 446(2), 180-192 (2018-12-31)
The evolutionarily conserved transcription factor, Tbx18, is expressed in a dynamic pattern throughout embryonic and early postnatal life and plays crucial roles in the development of multiple organ systems. Previous studies have indicated that this dynamic function is controlled by
Aafke Engwerda et al.
European journal of human genetics : EJHG, 26(10), 1478-1489 (2018-06-16)
Proximal 6q (6q11-q15) deletions are extremely rare and little is known about their phenotypic consequences. Since parents and caregivers now use social media to seek information on rare disorders, the Chromosome 6 Project has successfully collaborated with a Facebook group
Asaf Vivante et al.
American journal of human genetics, 97(2), 291-301 (2015-08-04)
Congenital anomalies of the kidneys and urinary tract (CAKUT) are the most common cause of chronic kidney disease in the first three decades of life. Identification of single-gene mutations that cause CAKUT permits the first insights into related disease mechanisms.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.