SAB1412054

ANTI-MTF1 antibody produced in mouse

clone 4A5, ascites fluid

• 동의어(들): MGC23036, MTF-1, MTF1, ZRF
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 4A5, monoclonal
• 분자량: antigen 36.74 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgMκ
• NCBI 수납 번호: NM_005955
• UniProt 수납 번호: Q14872
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MTF1(4520)

설명

일반 설명

This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE). (provided by RefSeq)

면역원

MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable