SAB1409896

Monoclonal Anti-TTF2 antibody produced in mouse

clone 3F7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): HuF2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3F7, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 39.38 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_003594
• UniProt 수납 번호: Q9UNY4
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TTF2(8458)

설명

일반 설명

This gene encodes a member of the SWI2/SNF2 family of proteins, which play a critical role in altering protein-DNA interactions. The encoded protein has been shown to have dsDNA-dependent ATPase activity and RNA polymerase II termination activity. This protein interacts with cell division cycle 5-like, associates with human splicing complexes, and plays a role in pre-mRNA splicing. (provided by RefSeq)

면역원

TTF2 (NP_003585, 385 a.a. ~ 509 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QFPDRSVQRKVSPASGVSKKVEPSDPVARRVYLTTQLKQKKSTLASVNIQALPDKGQKLIKQIQELEEVLSGLTLSPEQGTNEKSNSQVPQQSHFTKTTTGPPHLVPPQPLPRRGTQPVGSLELK

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable