SAB1409779

Monoclonal Anti-TWIST1 antibody produced in mouse

clone 3A2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): ACS3, BPES2, BPES3, SCS, TWIST, bHLHa38
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3A2, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen 37.07 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; indirect immunofluorescence: suitable
• 동형: IgG1κ
• NCBI 수납 번호: NM_000474
• UniProt 수납 번호: Q15672
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TWIST1(7291)

설명

일반 설명

Basic helix-loop-helix (bHLH) transcription factors have been implicated in cell lineage determination and differentiation. The protein encoded by this gene is a bHLH transcription factor and shares similarity with another bHLH transcription factor, Dermo1. The strongest expression of this mRNA is in placental tissue; in adults, mesodermally derived tissues express this mRNA preferentially. Mutations in this gene have been found in patients with Saethre-Chotzen syndrome. (provided by RefSeq)

면역원

TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable