SAB1404094

Monoclonal Anti-MUC5AC antibody produced in mouse

clone 2A4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MUC5
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2A4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• NCBI 수납 번호: XM_495860
• UniProt 수납 번호: P98088
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MUC5AC(4586)

설명

일반 설명

The MUC5AC (mucin 5AC, oligomeric mucus/gel-forming) gene is mapped to human chromosome 11p15.5. Muc5ac is a gel-forming mucin of 40MDa, secreted by the goblet cells of the conjunctiva. Muc5ac is localized to the intermediate aqueous layer of tear film and predominant mucin in the respiratory tract. Muc5ac protein consists of cysteine-rich domains that flanks the central glycosylated tandem repeat domain.

면역원

MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH

애플리케이션

Muc5ac (mucin 5AC, oligomeric mucus/gel-forming) provides hydration and lubrication effect for epithelial cells that make up cornea and conjunctiva. Parasympathetic and sympathetic nervous system (particularly, parasympathetic neurotransmitters acetylcholine and vasoactive intestinal peptide) controls the Muc5ac secretion. A number pathogens and cytokines can also stimulate Muc5ac secretion in the airway. MUC5AC gene expression is associated with a some pathological conditions such as allergen-induced airway hyperresponsiveness,airway mucus plugging, and mucous metaplasia.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable