SAB1403990

Monoclonal Anti-IRF4, (C-terminal) antibody produced in mouse

clone 2D1, purified immunoglobulin, buffered aqueous solution

• 동의어(들): LSIRF, MUM1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2D1, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~38.21 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2bκ
• NCBI 수납 번호: NM_002460
• UniProt 수납 번호: Q15306
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... IRF4(3662)

설명

일반 설명

Interferon regulatory factor 4 (IRF4), also known as multiple myeloma oncogene-1 (MUM1), is a transcription factor. It is encoded by the gene mapped to human chromosome 6p25.3. The protein is specifically expressed in lymphocytes.

면역원

IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

생화학적/생리학적 작용

Interferon regulatory factor 4 (IRF4) plays a vital role in regulation of immunoglobulin class switch recombination and plasma cell differentiation. In addition, it is also implicated in maintaining homeostasis of both mature B and mature T lymphocytes. Mutation in the gene is associated with the risk of developing chronic lymphocytic leukemia (CLL).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable