콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

SAB1403976

Sigma-Aldrich

Monoclonal Anti-IL13 antibody produced in mouse

clone 3H7, purified immunoglobulin, buffered aqueous solution

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

3H7, monoclonal

형태

buffered aqueous solution

분자량

antigen ~38.32 kDa

종 반응성

human

기술

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

동형

IgG2aκ

면역원 서열

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDELEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... IL13(3596)

일반 설명

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq

면역원

IL13 (NP_002179, 1 a.a. ~ 146 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

생화학적/생리학적 작용

Interleukin-13 (IL-13) has a role in immune activities against infections and influences the function of various cells taking part in the same. It has been studied to be overexpressed in glioblastoma tumors and cell lines. IL-13 stimulates fibrosis in many infectious diseases. Targeted deletion of IL-13 in mice resulted in impaired T-helper 2 (Th2) cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as tumor necrosis factor-α (TNF-α), interleukins-1β, -6 and -8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of immunoglobulin E (IgE). Blocking of IL-13 activity inhibits the pathophysiology of asthma.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Genetic variants of IL-13 signalling and human asthma and atopy.
Heinzmann A
Human Molecular Genetics, 9(4), 549-559 (2000)
T cell responses: naive to memory and everything in between.
Pennock ND
Advances in Physiology Education, 37(4), 273-283 (2013)
IL-4, IL-10 and IL-13 down-regulate monocyte-chemoattracting protein-1 (MCP-1) production in activated intestinal epithelial cells.
Kucharzik T
Clinical and Experimental Immunology, 111(1), 152-157 (1998)
IL-13 mediates IL-33-dependent mast cell and type 2 innate lymphoid cell effects on bronchial epithelial cells.
Deepti R Nagarkar et al.
The Journal of allergy and clinical immunology, 136(1), 202-205 (2015-03-19)
Yan Deng et al.
PloS one, 10(2), e0116682-e0116682 (2015-02-07)
Interleukin-13 (IL-13) is a potent pleiotropic cytokine that is produced by activated CD4 T cells. This study was undertaken to determine the relationship between two IL-13 gene single nucleotide polymorphisms (SNP rs1800925 and SNP rs20541) and the incidence of hepatitis

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.