추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4E3, monoclonal
양식
buffered aqueous solution
분자량
antigen 8.69 kDa
종 반응성
human
기술
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2bκ
NCBI 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... IL8(3576)
일반 설명
Interleukin 8 (IL-8) is an 8& kDa, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family. The IL-8 gene is mapped to human chromosomes 4q13.3. IL-8 chemokine is secreted by several cell types. The IL-8 gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
면역원
IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
생화학적/생리학적 작용
Elevated expression of IL-8 gene is observed in a number of cancers including chronic spontaneous urticaria and breast cancer, thus serves as a prognostic marker for the same. IL-8 regulates the metastasis and angiogenesis processes during cancer development. IL-8 is responsible for epithelial–mesenchymal transition which plays an important role in providing cancer cells the mobility to invade other neighbouring cells, thereby contributing to metastasis.
Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Interleukin 8: cells of origin in inflammatory bowel disease.
Grimm M C, et al.
Gut, 38(1), 90-98 (1996)
Purification of a human monocyte-derived neutrophil chemotactic factor that has peptide sequence similarity to other host defense cytokines.
Yoshimura T, et al.
Proceedings of the National Academy of Sciences of the USA, 84(24), 9233-9237 (1987)
Elevated plasma il-8 concentration is related to severity of systemic inflammation in chronic spontaneous urticaria.
Kasperska-Zajac A, et al.
Journal of Biological Regulators and Homeostatic Agents, 31(4), 957-961 (2017)
Sohlh2 suppresses epithelial to mesenchymal transition in breast cancer via downregulation of IL-8.
Ji S, et al.
Oncotarget, 7(31), 49411-49411 (2016)
Label-free electrochemical impedance biosensor to detect human interleukin-8 in serum with sub-pg/ml sensitivity.
Sharma R
Biosensors And Bioelectronics, 80, 607-613 (2016)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.