SAB1402754

Monoclonal Anti-DPAGT1 antibody produced in mouse

clone 1G1, purified immunoglobulin, buffered aqueous solution

• 동의어(들): ALG7, CDG-Ij, D11S366, DGPT, DPAGT, DPAGT2, G1PT, GPT, UAGT
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: ELISA (c); ELISA (i)
• 클론: 1G1, monoclonal
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1G1, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~35.13 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_001382
• UniProt 수납 번호: Q9H3H5
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DPAGT1(1798)

설명

일반 설명

The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. (provided by RefSeq)

면역원

DPAGT1 (NP_001373, 296 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable