SAB1402393

Monoclonal Anti-WNT5A antibody produced in mouse

clone 3A4, purified immunoglobulin, buffered aqueous solution

• 동의어(들): hWNT5A
• MDL number: MFCD07784920
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3A4, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: BC064694
• UniProt 수납 번호: P41221
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... WNT5A(7474)

설명

일반 설명

Wnt family member 5A (WNT5A) is a secreted, proinflammatory protein. It is part of the noncanonical WNT family. The gene encoding this protein is localized on human chromosome 3p14.3.

면역원

WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV

생화학적/생리학적 작용

Wnt family member 5A (WNT5A) has a role in metabolic dysfunction in obesity and negatively modulates angiogenesis in adipose tissue. The protein regulates cell motility and polarity by activating β-catenin–independent pathways. It has been shown to be overexpressed in gliomas.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable