추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
4H3, monoclonal
양식
buffered aqueous solution
분자량
antigen ~33.7 kDa
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GNRH1(2796)
관련 카테고리
면역원
GNRH1 (NP_000816, 24 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
Sequence
QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
생화학적/생리학적 작용
GNRH (gonadotropin releasing hormone 1) controls the production of follicle-stimulating hormone and luteinizing hormone from pituitary gland. Mutation in the gene is associated with idiopathic hypogonadotropic hypogonadism.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
11 - Combustible Solids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Jérôme Bouligand et al.
The New England journal of medicine, 360(26), 2742-2748 (2009-06-19)
We investigated whether mutations in the gene encoding gonadotropin-releasing hormone 1 (GNRH1) might be responsible for idiopathic hypogonadotropic hypogonadism (IHH) in humans. We identified a homozygous GNRH1 frameshift mutation, an insertion of an adenine at nucleotide position 18 (c.18-19insA), in
Estee Stern et al.
The Journal of biological chemistry, 292(23), 9815-9829 (2017-04-08)
Neuroendocrine control of reproduction by brain-secreted pulses of gonadotropin-releasing hormone (GnRH) represents a longstanding puzzle about extracellular signal decoding mechanisms. GnRH regulates the pituitary gonadotropin's follicle-stimulating hormone (FSH) and luteinizing hormone (LH), both of which are heterodimers specified by unique
Isolated familial hypogonadotropic hypogonadism and a GNRH1 mutation.
Bouligand J
The New England Journal of Medicine, 360(26), 2742-2748 (2009)
GNRH1 mutations in patients with idiopathic hypogonadotropic hypogonadism.
Chan YM
Proceedings of the National Academy of Sciences of the USA, 106(28), 11703-11708 (2009)
Modeling and high-throughput experimental data uncover the mechanisms underlying Fshb gene sensitivity to gonadotropin-releasing hormone pulse frequency.
Stern E
The Journal of Biological Chemistry, 292(23), 9815-9829 (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.