SAB1401724

Monoclonal Anti-SSH1 antibody produced in mouse

clone 2F9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): FLJ38102, KIAA1298, SSH-1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2F9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: capture ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_018984
• UniProt 수납 번호: Q8WYL5
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SSH1(54434)

설명

일반 설명

The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM

면역원

SSH1 (NP_061857.2, 752 a.a. ~ 849 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTTNSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAS

애플리케이션

Monoclonal Anti-SSH1 antibody produced in mouse is suitable for capture ELISA and western blot assay.

생화학적/생리학적 작용

SSH1 (Slingshot protein phosphatase 1) is mainly involved in the actin filament organization. During cytokinesis, it reactivates ADF (actin-depolymerizing factor)/cofilin, which plays a major role in actin filament dynamics and cell migration. Apart from cofilin reactivation, it also dephosphorylates P-cofilin in vitro and in vivo. Overexpression of SSH1 has been reported in pancreatic cancer (PC) cells, which indicates its role in tumor cell migration via SSH1L/cofilin-1 signal pathway.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable