추천 제품
생물학적 소스
human
Quality Level
재조합
expressed in HEK 293 cells
분석
≥98% (SDS-PAGE)
형태
lyophilized powder
효능
≥98% Heavy amino acids incorporation efficiency by MS
분자량
calculated mol wt 17 kDa
기술
mass spectrometry (MS): suitable
적합성
suitable for mass spectrometry (internal calibrator)
UniProt 수납 번호
저장 온도
−20°C
유전자 정보
human ... IFNG(3458)
일반 설명
Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.
면역원
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
생화학적/생리학적 작용
SILu™Lite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
물리적 형태
Lyophilized from a solution of phosphate buffered saline.
법적 정보
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.