HPA049374

Anti-SNX6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-sorting nexin 6
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA049374
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
• UniProt 수납 번호: Q9UNH7
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SNX6(58533)

설명

일반 설명

Sorting nexin 6 (SNX6) has N-terminal phosphoinositide‐binding phox homology (PX) domain and a C-terminal BAR (Bin/amphiphysin/Rvc) domain. The SNX6 gene is mapped to human chromosome 14q13.1. It is expressed in two isoforms and has high expression in heart, skeletal muscle, and placenta. It shows low expression in lungs and liver.

면역원

sorting nexin 6 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

Sorting nexin 6 (SNX6) is involved in endosomal sorting. It interacts with receptor serine-threonine kinases and transforming growth factor-β (TGF-β) family of peptides. It coordinates with sorting nexin 5 (SNX5) and hinders phosphatidylinositol phosphate kinases (PIPKIγi5)-mediated E-cadherin degradation. SNX6 mediates the transport of cation-independent mannose-6-phosphate (CI-MPR) from endosome to trans-Golgi-network. SNX6 interacts with dynein motor complex and regulates the formation of tubular retrograde intermediates. SNX6 interacts with lamin A and regulates its synthesis and incorporation into the nuclear envelope.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST85090

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable