추천 제품
생물학적 소스
rabbit
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500
면역원 서열
MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PLAC8(51316)
일반 설명
Placenta specific 8 (PLAC8), also known as onzin, is encoded by the gene mapped to human chromosome 4q21.23. PLAC8 is a 12.5kDa, 112 amino acid protein characterized with a cysteine-rich domain.
면역원
placenta-specific 8 recombinant protein epitope signature tag (PrEST)
애플리케이션
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper) and is also used in immunohistochemical staining.
Western Blotting (1 paper) and is also used in immunohistochemical staining.
생화학적/생리학적 작용
Placenta specific 8 (PLAC8) plays a vital role in the regulation of brown adipocyte differentiation and function. Decreased expression of PLAC8 enhances the activity of phosphoinositide 3-kinase (PI3K)/Akt/glycogen synthase kinase 3 β (GSK3β) and Wnt/β-catenin signaling pathway to stimulate hepatocellular carcinoma cell proliferation. PLAC8 is highly expressed ectopically in advanced preneoplastic lesions and invasive human pancreatic ductal adenocarcinoma (PDAC). Thus, it can be considered as a potential diagnostic and therapeutic target for pancreatic cancer.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70157
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
Emily K Blue et al.
Diabetes, 64(7), 2664-2675 (2015-02-28)
Intrauterine exposure to gestational diabetes mellitus (GDM) is linked to development of hypertension, obesity, and type 2 diabetes in children. Our previous studies determined that endothelial colony-forming cells (ECFCs) from neonates exposed to GDM exhibit impaired function. The current goals
Carlos Galaviz-Hernandez et al.
Gene, 309(2), 81-89 (2003-05-22)
Microarray expression profiling of a collection of 15,000 mouse genes with placental and embryonic RNAs revealed candidates for placental-enriched genes, three of which we have confirmed and further characterized. One, Plac1, strongly expressed in all trophoblast-derived cells in the placenta
Zhu Jin et al.
Biochemical and biophysical research communications, 499(3), 538-543 (2018-03-30)
Non-small cell lung carcinoma is the predominant type of lung cancer, and shows an easily developable tolerance to radiotherapy. Cancer stem cells are suggested to be involved in the resistance against therapies. Onzin might be accumulated during the process tumor
Lei Zou et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 84, 139-146 (2016-09-20)
Hepatocellular carcinoma (HCC) is a common, prevalent malignancy. Its poor prognosis is mainly related to high rate of diagnosis in non-curable stages, in which patients are suitable for palliative treatment. Placenta-specific 8 (PLAC8), also known as Onzin, is a small
Marina Tatura et al.
Neuroendocrinology, 110(1-2), 23-34 (2019-04-25)
Many aspects of the biology of pancreatic neuroendocrine tumors (PanNETs), including determinants of proliferative, invasive, and metastatic potential, remain poorly understood. Placenta-specific 8 (PLAC8), a gene with unknown molecular function, has been reported to have tumor-promoting roles in different human
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.