콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

SAB1401635

Sigma-Aldrich

Anti-LAMP3 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

동의어(들):

CD208, DC-LAMP, DCLAMP, LAMP, TSC403

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

Quality Level

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

종 반응성

human

기술

western blot: 1 μg/mL

NCBI 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LAMP3(27074)

면역원

LAMP3 (AAH32940.1, 1 a.a. ~ 416 a.a) full-length human protein.

Sequence
MPRQLSAAAALFASLAVILHDGSQMRAKAFPGTRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETVYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI

생화학적/생리학적 작용

LAMP3 (lysosomal associated membrane protein 3) is tumor-specific protein and induced by hypoxia. It is known to be associated with tumors, inflammation and the maturation of dendritic cells. LAMP3 is found to be associated with Salmonella infection and promotes its intracellular proliferation. Upregulation of the gene is observed in a number of cancer such as cervical, breast, and gastrointestinal cancer and in lymph node metastasis. Increased expression of the gene shows resistance to chemotherapy and radiotherapy, and, LAMP3 might be responsible for tumor metastasis. In vitro studies point out that LAMP3 promotes invasion and migration of tumor cells.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Xiaoxia Qiu et al.
International journal of clinical and experimental pathology, 8(5), 5519-5527 (2015-07-21)
Lysosomal associated membrane protein 3 (LAMP3) is a newly identified tumor-specific and hypoxia-induced protein. It is a downstream target gene of tumor suppressor TP53 and its expression has been associated with hypoxia-induced metastasis and poor overall survival in cervical, breast
L Malaguarnera et al.
Cellular immunology, 311, 13-21 (2016-10-05)
The family of lysosome-associated membrane proteins (LAMPs) encompassing LAMP1, LAMP2 and DC-LAMP (LAMP3) are the major constituents of the glycoconjugates coat present on the inside of the lysosomal membrane. LAMP3 is highly expressed only in certain cell types and during
Eun-Ju Lee et al.
Molecules and cells, 39(7), 566-572 (2016-06-23)
Lysosomes are cellular organelles containing diverse classes of catabolic enzymes that are implicated in diverse cellular processes including phagocytosis, autophagy, lipid transport, and aging. Lysosome-associated membrane proteins (LAMP-1 and LAMP-2) are major glycoproteins important for maintaining lysosomal integrity, pH, and
Xiaoyu Liao et al.
International journal of molecular sciences, 16(8), 17655-17667 (2015-08-13)
Lysosomal-associated membrane protein 3 (LAMP3), identified as a molecular marker of mature dendritic cells, is one of the LAMP family members. Its expression was induced by hypoxia, and was associated with hypoxia mediated metastasis in breast and cervical cancers. However
High Expression of LAMP3 Is a Novel Biomarker of Poor Prognosis in Patients with Esophageal Squamous Cell Carcinoma.
Liao X
International Journal of Molecular Sciences, 16(8), 17655-17667 (2015)

Global Trade Item Number

SKUGTIN
SAB1401635-50UG4061831643039

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.