콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA026817

Sigma-Aldrich

Anti-PCDH17 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Protocadherin-17, Anti-Protocadherin-68

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

VNDNAPVIVLPTLQNDTAELQVPRNAGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVELVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWD

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PCDH17(27253)

일반 설명

The protocadherin 17 (PCDH17) gene, mapped to human chromosome 13q21.2, codes for a neuronal cell adhesion molecule, PCDH17. The encoded protein belongs to the cadherin superfamily and is predominantly expressed in focal regions of the human prefrontal cortex. PCDH17 is predominantly expressed in the exterior margins of the thalamus, ventromedial striatal neuroepithelium, and anterior cingulate.

면역원

Protocadherin-17 Precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PCDH17 antibody produced in rabbit has been used in immunofluorescence staining. All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Methylation of protocadherin 17 (PCDH17) in serum repeatedly at the initial stage of prostate cancer, can serve as potential marker for the biochemical recurrence (BCR) of prostate cancer after radical prostatectomy. Genistein up-regulates PCDH17 mRNA expression and facilitates gene promoter demethylation and cell cycle arrest in gastric cancer. The encoded protein acts as a tumor suppressor gene in NPC (nasopharyngeal carcinoma), colorectal cancer and esophageal squamous cell carcinoma (ESCC).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70119

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Xuedong Yin et al.
Oncotarget, 7(32), 51720-51732 (2016-06-29)
Protocadherins play important roles in the regulation of cell adhesion and signaling transduction. Aberrant expression of protocadherins has been shown to be associated with multiple tumorigenesis. We previously identified PCDH17, encoding protocadherin 17, as a frequently methylated and downregulated tumor
Protocadherin 17 functions as a tumor suppressor suppressing Wnt/?-catenin signaling and cell metastasis and is frequently methylated in breast cancer.
Yin X
Oncotarget, 7(32), 51720-51732 (2016)
Methylation status of the PCDH17 gene promoter in Nasopharyngeal carcinoma
Qin H
Journal of Chongqing Medical University null
Aberrant Protocadherin17 (PCDH17) Methylation in Serum is a Potential Predictor for Recurrence of Early-Stage Prostate Cancer Patients After Radical Prostatectomy.
Lin YL
Medical Science Monitor : International Medical Journal of Experimental and Clinical Research, 21, 3955-3690 (2015)
Frequent silencing of protocadherin 17, a candidate tumour suppressor for esophageal squamous cell carcinoma.
Haruki S
Carcinogenesis, 31(6), 1027-1036 (2010)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.