HPA025020

Anti-TMEM65 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Transmembrane protein 65
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA025020
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• 면역원 서열: EALNTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEAPPPT
• UniProt 수납 번호: Q6PI78
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TMEM65(157378)

설명

일반 설명

The gene TMEM65 (transmembrane protein 65) is mapped to human chromosome 8q24. In mouse, it is mainly expressed in the heart tissue. The encoded protein localizes to the inner membrane of mitochondria. In cardiac cell, it is membrane associated and localizes in the intercalated disc. The protein has putative transmembrane regions and a mitochondrial targeting signal.

면역원

Transmembrane protein 65 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.
Anti-TMEM65 antibody produced in rabbit has been used for Western blotting, immunofluorescence and immunocytochemistry.

생화학적/생리학적 작용

TMEM65 (transmembrane protein 65) might be involved in mitochondrial functions and in the development of French-Canadian Leigh syndrome (LSFC). It can also serve as a marker for checking the development and maturation of human ventricular cardiomyocytes. It binds to connexin 43 (Cx43) and helps in proper localization of Cx43 to the intercalated disc.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST76345

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable