콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

HPA024802

Sigma-Aldrich

Anti-SLC19A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-FOLT, Anti-solute carrier family 19 (folate transporter), member 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

면역원 서열

AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SLC19A1(6573)

일반 설명

The gene SLC19A1 (solute carrier family 19 member 1) is mapped to human chromosome 21q22. It is expressed in many tissues, mainly enterocytes and hepatocytes.

면역원

solute carrier family 19 (folate transporter), member 1 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SLC19A1 antibody produced in rabbit has been used in western blotting.

생화학적/생리학적 작용

At physiological pH, SLC19A1 (solute carrier family 19 member 1) is involved in the transfer of reduced folates into the cells. It is also involved in the uptake of the antifolate methotrexate. In osteosarcoma and neuroblastoma, decrease in the activity of SLC19A1 leads to methotrexate resistance. In patients with colorectal cancer, high expression of SLC19A1 reduces risk of recurrent disease (disease-free survival). SLC19A1 might be linked with non-syndromic cleft lip and palate and neural tube defects. Additionally, mutations in SLC19A1 gene are associated with risk of ischemic stroke.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73240

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Adipocyte expression of SLC19A1 links DNA hypermethylation to adipose tissue inflammation and insulin resistance
Petrus P, et al.
The Journal of Clinical Endocrinology and Metabolism, 103(2), 710-721 (2017)
Elixabet Lopez-Lopez et al.
The Journal of clinical investigation, 130(12), 6600-6615 (2020-11-10)
BACKGROUNDInterpatient differences in the accumulation of methotrexate's active polyglutamylated metabolites (MTXPGs) in leukemia cells influence its antileukemic effects.METHODSTo identify genomic and epigenomic and patient variables determining the intracellular accumulation of MTXPGs, we measured intracellular MTXPG levels in acute lymphoblastic leukemia
H L Hébert et al.
The British journal of dermatology, 166(3), 474-482 (2011-11-05)
The era of genome-wide association studies has revolutionized the search for genetic susceptibility loci in complex genetic conditions such as psoriasis. There are currently 16 loci with confirmed evidence for association with psoriasis susceptibility but there is the potential for
Camille Alam et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 34(8), 10516-10530 (2020-06-17)
Folates are important for neurodevelopment and cognitive function. Folate transport across biological membranes is mediated by three major pathways: folate receptor alpha (FRα), proton-coupled folate transporter (PCFT), and reduced folate carrier (RFC). Brain folate transport primarily occurs at the choroid
Aurea Lima et al.
Toxicological sciences : an official journal of the Society of Toxicology, 142(1), 196-209 (2014-08-16)
Methotrexate (MTX) is used for rheumatoid arthritis (RA) treatment showing a wide toxicity profile. This study aimed to evaluate the influence of single nucleotide polymorphisms (SNPs) in genes encoding for MTX transporters with the occurrence of MTX-related toxicity (overall and

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.