콘텐츠로 건너뛰기
Merck
모든 사진(9)

주요 문서

HPA018425

Sigma-Aldrich

Anti-G3BP2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-G3BP-2, Anti-GAP SH3 domain-binding protein 2, Anti-Ras GTPase-activating protein-binding protein 2

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:50-1:200

면역원 서열

KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... G3BP2(9908)

일반 설명

The gene G3BP2 (GAP SH3 domain-binding protein-2) has been mapped to human chromosome 4q21.1. G3BP2 is ubiquitously expressed and is mainly present in the cytoplasm. However, it is capable of shuttling into the nucleus in cell-cycle dependent manner. G3BP2 include an NTF2 (nuclear transport factor)-like domain and two RNA-binding motifs.

면역원

Ras GTPase-activating protein-binding protein 2 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-G3BP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

GAP SH3 domain-binding protein-2 (G3BP2) is identified as a gene for predicting the presence of lymph node metastasis in primary oral squamous cell carcinoma. G3BP2 is a negative modulator of p53 function. Depletion of G3BP2 leads to up-regulation of p53 and its overexpression leads to the cytoplasmic redistribution of p53. G3BP2 binds mechanomediator TWIST1 in the cytoplasm. Loss of G3BP2 leads to nuclear localization of TWIST1 which in response to biomechanical signals induce epithelial-mesenchymal transition, promoting tumor invasion and metastasis. Overexpression of G3BP2 induces formation of cytoplasmic RNA granules called stress granules (SGs). Knockdown of G3BP2 reduces the number of SG-positive cells. During Semliki Forest virus infection, the C-terminal domain of the viral nonstructural protein-3 forms a complex with G3BP2 and inhibits the formation of SGs on viral mRNAs, thus impairing antiviral defense.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73970

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Elad Katz et al.
Oncotarget, 3(6), 608-619 (2012-06-13)
High expression of Rac small GTPases in invasive breast ductal carcinoma is associated with poor prognosis, but its therapeutic value in human cancers is not clear. The aim of the current study was to determine the response of human primary
M M Kim et al.
Oncogene, 26(29), 4209-4215 (2007-02-14)
Inactivation of the p53 tumor suppressor pathway is a critical step in human tumorigenesis. In addition to mutations, p53 can be functionally silenced through its increased degradation, inhibition of its transcriptional activity and/or its inappropriate subcellular localization. Using a proteomic
Ying Sun et al.
Oncogene, 38(24), 4856-4874 (2019-02-26)
Identification of molecular alterations driving breast cancer progression is critical for the development of effective therapy. In this study, we show that the level of α-parvin is elevated in triple-negative breast cancer cells. The depletion of α-parvin from triple-negative breast
Amy E Rose et al.
Cancer research, 71(7), 2561-2571 (2011-02-24)
Superficial spreading melanoma (SSM) and nodular melanoma (NM) are believed to represent sequential phases of linear progression from radial to vertical growth. Several lines of clinical, pathologic, and epidemiologic evidence suggest, however, that SSM and NM might be the result
Fátima Solange Pasini et al.
Acta oncologica (Stockholm, Sweden), 51(1), 77-85 (2011-10-12)
Previous knowledge of cervical lymph node compromise may be crucial to choose the best treatment strategy in oral squamous cell carcinoma (OSCC). Here we propose a set four genes, whose mRNA expression in the primary tumor predicts nodal status in

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.