HPA018304
Anti-G3BP2 antibody produced in rabbit
![Enhanced Validation antibodies are tested to ensure reproducibility, specificity, and performance using our enhanced validation strategies enhanced validation](/static/enhanced_validation_badge.png)
affinity isolated antibody, buffered aqueous glycerol solution
동의어(들):
G3BP2 Antibody - Anti-G3BP2 antibody produced in rabbit, G3Bp2 Antibody, Anti-G3BP-2, Anti-GAP SH3 domain-binding protein 2, Anti-Ras GTPase-activating protein-binding protein 2
로그인조직 및 계약 가격 보기
모든 사진(8)
About This Item
추천 제품
생물학적 소스
rabbit
Quality Level
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation
기술
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
면역원 서열
HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEPEPEPESETKTEELKPQVE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... G3BP2(9908)
일반 설명
The gene G3BP2 (GAP SH3 domain-binding protein-2) has been mapped to human chromosome 4q21.1. G3BP2 is ubiquitously expressed and is mainly present in the cytoplasm; however, it is capable of shuttling into the nucleus in cell-cycle dependent manner. G3BP2 contains an NTF2 (nuclear transport factor 2)-like domain and two RNA-binding motifs.
면역원
Ras GTPase-activating protein-binding protein 2 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-G3BP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Immunohistochemistry (1 paper)
생화학적/생리학적 작용
G3BP2 (GAP SH3 domain-binding protein-2) is identified as a gene for predicting the presence of lymph node metastasis in primary oral squamous cell carcinoma. G3BP2 is a negative modulator of p53 function. Depletion of G3BP2 leads to up-regulation of p53 and its overexpression leads to the cytoplasmic redistribution of p53. G3BP2 binds mechanomediator TWIST1 (Twist-related protein 1) in the cytoplasm. Loss of G3BP2 leads to nuclear localization of TWIST1 which in response to biomechanical signals induces epithelial-mesenchymal transition, promotes tumor invasion and metastasis. Overexpression of G3BP2 induces formation of cytoplasmic RNA granules called stress granules (SGs). Knockdown of G3BP2 reduce the number of SG-positive cells. During Semliki Forest virus infection, the carboxyl-terminal domain of the viral nonstructural protein 3 forms a complex with G3BP2 and inhibits the formation of SGs on viral mRNAs, thus impairing antiviral defense.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST73969
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
가장 최신 버전 중 하나를 선택하세요:
Francisco Dominguez et al.
Journal of virology, 95(16), e0083621-e0083621 (2021-06-03)
Chikungunya virus (CHIKV) is one of the most pathogenic members of the Alphavirus genus in the Togaviridae family. Within the last 2 decades, CHIKV has expanded its presence to both hemispheres and is currently circulating in both Old and New
Elad Katz et al.
Oncotarget, 3(6), 608-619 (2012-06-13)
High expression of Rac small GTPases in invasive breast ductal carcinoma is associated with poor prognosis, but its therapeutic value in human cancers is not clear. The aim of the current study was to determine the response of human primary
Kathleen M Attwood et al.
Cell death & disease, 11(11), 989-989 (2020-11-19)
Glioblastoma (GBM) is the most common primary malignant brain tumor, and it has a uniformly poor prognosis. Hypoxia is a feature of the GBM microenvironment, and previous work has shown that cancer cells residing in hypoxic regions resist treatment. Hypoxia
Shan Ying et al.
Journal of cell science, 133(20) (2020-09-30)
Translation arrest is a part of the cellular stress response that decreases energy consumption and enables rapid reprioritisation of gene expression. Often translation arrest leads to condensation of untranslated messenger ribonucleoproteins (mRNPs) into stress granules (SGs). Studies into mechanisms of
M M Kim et al.
Oncogene, 26(29), 4209-4215 (2007-02-14)
Inactivation of the p53 tumor suppressor pathway is a critical step in human tumorigenesis. In addition to mutations, p53 can be functionally silenced through its increased degradation, inhibition of its transcriptional activity and/or its inappropriate subcellular localization. Using a proteomic
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.