HPA017737

Anti-PI3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-ESI, Anti-Elafin precursor, Anti-Elastase-specific inhibitor, Anti-Peptidase inhibitor 3, Anti-Protease inhibitor WAP3, Anti-SKALP, Anti-Skin-derived antileukoproteinase, Anti-WAP four- disulfide core domain protein 14
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA017737
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunohistochemistry: 1:2500- 1:5000
• 면역원 서열: KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
• UniProt 수납 번호: P19957
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PI3(5266)

설명

일반 설명

Peptidase inhibitor 3 (PI3) is an endogenous serine protease inhibitor which is expressed in the epithelium of the gastrointestinal tract. It is a 9.9kDa protein consisting of 95 amino acids. PI3 belongs to the chelonianin family of proteins and the gene encoding it is localized on chromosome 20.

면역원

Elafin precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Peptidase inhibitor 3 (PI3) has an inhibitory effect against various elastases and proteinases. It is a substrate of tissue transglutaminase 2 (TG-2), which has a cross-linking activity. In cardiovascular, respiratory and colonic inflammation, PI3 shows anti-inflammatory effects and barrier modifying properties. It is called an “alarm” antiproteinase, since it is secreted at the sites of inflammation by the same stimuli that causes initial inflammatory response. It has been shown that PI3 is overexpressed in basal-like breast cancer tumors and high-grade serous ovarian carcinoma. PI3 may also act as a marker of renal inflammation and injury.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70807

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)