HPA014764

Anti-DSE antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Chondroitin-glucuronate 5-epimerase, Anti-DS epimerase, Anti-DSE, Anti-Dermatan-sulfate epimerase precursor, Anti-SART-2, Anti-SART2 antibody produced in rabbit, Anti-Squamous cell carcinoma antigen recognized by T-cells 2
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA014764

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: FRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYT
• UniProt 수납 번호: Q9UL01
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DSE(29940)

설명

일반 설명

DSE (dermatan sulfate epimerase) was initially identified as a squamous cell carcinoma antigen, and was named SART2 (squamous cell carcinoma antigen recognized by T cells 2). This protein is composed of 958 amino acids. It resides in endoplasmic reticulum and partly in Golgi bodies, and has its transmembrane domain at its N-terminal. It has four putative N-glycosylation sites, and its catalytic site is present at the groove of two domains. This gene is present on human chromosome 6q22, has six exons, and codes for a protein with molecular weight of 100kDa.

면역원

Dermatan-sulfate epimerase precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

DSE (dermatan sulfate epimerase) is responsible for the epimerization of GlcUA (glucuronic acid) into IdoUA (iduronic acid) in chondroitin chains, and the conversion of IdoUA into GlcUA in dermatans. Mutation in this gene is associated with musculocontractural Ehlers-Danlos syndromes (MCEDS), which is an outcome of abnormalities in dermatan sulfate (DS) synthesis. It is up-regulated in squamous cell carcinomas, and has three different N-glycosylated isoforms. It is also overexpressed in esophagus squamous cell carcinoma (ESCC), and its inactivation leads to reduced IdaUA levels, leading to decreased tumor migration and invasiveness. It is expressed in glioma, gynecological cancer, pancreatic cancer, colorectal carcinoma, and prostate cancer. Its expression is not seen in breast cancer cells.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73071

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)