HPA010926

Anti-ALCAM antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Activated leukocyte-cell adhesion molecule antibody produced in rabbit, Anti-CD166 antigen precursor antibody produced in rabbit
• MDL number: MFCD01865427
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA010926
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunohistochemistry: 1:50-1:200
• 면역원 서열: NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR
• UniProt 수납 번호: Q13740
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... ALCAM(214)

설명

일반 설명

Activated leukocyte cell adhesion molecule (ALCAM) belongs to the superfamily of immunoglobulin cell adhesion molecules (Ig-CAMs). Its extracellular domain consist of five immunoglobulin (Ig)-like domains, which aid in cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. It is a type I transmembrane protein. It has a short cytoplasmic tail and a transmembrane region, and has a molecular weight of 110kDa. It is expressed in a wide range of tissues, especially in the epithelia and the corresponding cancers. ALCAM gene maps to human chromosome 3q13.1-q13.2.

면역원

CD166 antigen precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-ALCAM antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Activated leukocyte cell adhesion molecule (ALCAM) mediates cell-cell adhesion, either through heterophilic (ALCAM-CD6) or homophilic (ALCAM-ALCAM) interactions. Hemophilic interactions aid in cell migration and invasiveness of tumor cells. ALCAM present on dendritic cells, induces T-cell activation by interacting with cluster of differentiation 6 (CD6) present on T-cells. This heterophilic interaction is necessary for the stabilization of immunological synapses. It mediates the extravasation of leukocytes and their transport to the central nervous system, as well as axonal fasciculation. Colorectal cancer patients, who show increased levels of ALCAM shedding, have poor prognosis and survival rates. The soluble form of ALCAM is related to the aggressive type II phenotype of epithelial ovarian cancer, and can be used as a marker for the same.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72229

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)