콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

HPA010024

Sigma-Aldrich

Anti-CADM2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Cell adhesion molecule 2 precursor, Anti-Immunoglobulin superfamily member 4D, Anti-Nectin-like protein 3

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:20- 1:50

면역원 서열

EIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CADM2(253559)

일반 설명

CADM2 (cell adhesion molecule 2) is a member of the CADM family, which in turn belongs to the immunoglobulin (Ig) superfamily. All the members of this family are composed of three extracellular Ig-like loops, a transmembrane domain and an intracellular region. This gene is localized to human chromosome 3p12.1, and is alternatively spliced to two isoforms- CADM2a and CADM2b.

면역원

Cell adhesion molecule 2 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

CADM2 (cell adhesion molecule 2) is significantly donw-regulated in HCC (hepatocellular carcinoma), and this is linked with poor recurrence-free survival (RFS). Its expression in HCC is linked with differentiation, serum a-fetoprotein, vascular invasion and hepatitis B surface antigen (HBsAg). CADM2 functions as a tumor suppressor, and abnormal methylation leading to its inactivation is linked with human renal cell carcinoma tumor progression and human prostate cancer. It functions as a guidance molecule for post-crossing commissural axons, and is critical for the formation and plasticity of synapse. Inactivation of this gene results in abnormal axon-axon interaction, leading to deregulated pathfinding of sensory neurons. A new splicing variant of CADM2 is a pathogenesis factor for psoriasis.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71600

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Sen Yang et al.
Journal of cancer research and clinical oncology, 140(1), 109-116 (2013-11-19)
To investigate the expression and clinical significance of CADM2 in hepatocellular carcinomas (HCC). The level of expression of CADM2 mRNA was assessed in frozen tumor specimens and adjacent noncancerous tissues from 30 HCC patients by real-time PCR. The protein level
Jeannine A Frei et al.
Journal of cell science, 127(Pt 24), 5288-5302 (2014-10-23)
Synaptic cell adhesion molecules (SynCAMs) are crucial for synapse formation and plasticity. However, we have previously demonstrated that SynCAMs are also required during earlier stages of neural circuit formation because SynCAM1 and SynCAM2 (also known as CADM1 and CADM2, respectively)
Azusa Hiruma et al.
Biochemical and biophysical research communications, 412(4), 626-632 (2011-08-26)
CADM2, a candidate gene for psoriasis, was identified by a genome-wide association study using microsatellites in the Japanese population (561 cases and 561 controls). Moreover, haplotype analysis included an additional 68 SNPs and indicated that a 110-kb haplotype block was
Wei He et al.
Biochemical and biophysical research communications, 435(4), 526-532 (2013-05-07)
Cell adhesion molecules (CADMs) comprise a protein family whose functions include maintenance of cell polarity and tumor suppression. In this report, we show that the CADM2 gene is repressed in human clear renal cell carcinoma by DNA promoter hypermethylation and/or
Guimin Chang et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 16(22), 5390-5401 (2010-11-11)
Cell adhesion molecules (CADM) comprise a newly identified protein family whose functions include cell polarity maintenance and tumor suppression. CADM-1, CADM-3, and CADM-4 have been shown to act as tumor suppressor genes in multiple cancers including prostate cancer. However, CADM-2

Global Trade Item Number

SKUGTIN
HPA010024-100UL4061835669974
HPA010024-25UL4061842816309

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.