HPA006353

Anti-SCUBE2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Protein CEGP1, Anti-Signal peptide, CUB and EGF-like domain-containing protein 2
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA006353

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunohistochemistry: 1:50- 1:200
• 면역원 서열: ESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSC
• UniProt 수납 번호: Q9NQ36
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SCUBE2(57758)

설명

일반 설명

SCUBE2 (signal peptide, CUB domain, EGF-like 2) was originally recognized in endothelium and multiple nonendothelial primary cell types. In normal breasts, it is expressed in vascular endothelial and mammary ductal epithelial cells. It is a member of the evolutionary conserved small family called SCUBE. This family contains three members. SCUBe2 contains around five motifs namely, a leader peptide in its N-terminal, nine tandem EGF-like repeats, a large spacer region which is N-glycosylated, three repeated stretches of 6-cysteine residues, and a C-terminal with one CUB domain.

면역원

Signal peptide, CUB and EGF-like domain-containing protein 2 Precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SCUBE2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

SCUBE2 (signal peptide, CUB domain, EGF-like 2) shows aberrant expression in breast cancer, and plays a role in tumorigenesis. It inhibits breast cancer cell proliferation, and its expression is linked to good prognosis. Thus, it might have potential as a marker for breast cancer. It inhibits breast tumor growth by acting as negative regulator of BMP (bone morphogenetic protein), and inhibiting the β-catenin pathway. It also prevents breast tumor invasion and migration by inhibiting epithelial-mesenchymal transition.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70280

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable