HPA005830

Anti-L1CAM antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-CD171 antigen antibody produced in rabbit, Anti-N-CAM L1 antibody produced in rabbit, Anti-Neural cell adhesion molecule L1 precursor antibody produced in rabbit
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA005830

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunohistochemistry: 1:200- 1:500
• 면역원 서열: ELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATE
• UniProt 수납 번호: P32004
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... L1CAM(3897)

설명

일반 설명

The gene L1CAM (L1 cell adhesion molecule) encodes a member of the immunoglobulin supergene family. The encoded protein contains a cytoplasmic intracellular domain, one single-pass transmembrane region and an extracellular domain containing six immunoglobulin- (Ig) and five fibronectin (Fn) III-like motifs. The gene is mapped to human chromosome Xq28. It contains 29 exons that encode a protein of 1257 amino acids containing a 19 amino acid signal peptide and a functional L1 protein of 1238 amino acids. It is mainly expressed in the nervous system.

면역원

Neural cell adhesion molecule L1 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-L1CAM antibody has been used to print on epoxy slides prior to EV capturing and analysis. All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

생화학적/생리학적 작용

The gene L1CAM (L1 cell adhesion molecule) encodes a glycoprotein that functions in axon growth during development and axon bundling. It interacts with Schwann cells and axons, and mediates neuronal cell migration, and neuronal cell survival. Overexpression of this protein is associated with tumor progression. It has been found to mediate therapeutic resistance in ovarian and pancreatic cancer cells.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST74285

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)