HPA005724

Anti-VASP antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): VASP Antibody - Anti-VASP antibody produced in rabbit, Vasp Antibody, Anti-VASP, Anti-Vasodilator-stimulated phosphoprotein
• MDL number: MFCD01634352
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA005724

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human, rat, mouse
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• 면역원 서열: PKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVK
• UniProt 수납 번호: P50552
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... VASP(7408)

설명

일반 설명

VASP gene is located on human chromosome 19q13.2.

Vasodilator-stimulated phosphoprotein (VASP) is an adhesion protein. It belongs to the conserved family of actin regulatory proteins made up of an EVH1 domain, an EVH2 domain and a proline-rich central region.

면역원

Vasodilator-stimulated phosphoprotein recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)
Western Blotting (1 paper)

생화학적/생리학적 작용

Vasodilator-stimulated phosphoprotein (VASP) associates with the barbed ends of actin filaments and takes part in the antagonize filament capping, by interacting with the capping protein (CapZ). It reduces the density of Arp2/3-dependent actin filament branches and bind profilin at sites of actin polymerization. The N-terminal EVH1 domain interacts with proteins associated with focal adhesion plaques. The central proline-rich region interacts with SH3 domains and profilins. The C-terminal EVH2 domain aids in the tetramerization of actin by interacting with polymerized actin fibres.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST70083

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)