콘텐츠로 건너뛰기
Merck
모든 사진(4)

주요 문서

HPA005700

Sigma-Aldrich

Anti-MAPK3/ERK1 Antibody

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

동의어(들):

Anti-ERK-1 antibody produced in rabbit, Anti-ERT2 antibody produced in rabbit, Anti-Extracellular signal-regulated kinase 1 antibody produced in rabbit, Anti-Insulin-stimulated MAP2 kinase antibody produced in rabbit, Anti-MAP kinase 1 antibody produced in rabbit, Anti-MAPK 1 antibody produced in rabbit, Anti-Microtubule-associated protein 2 kinase antibody produced in rabbit, Anti-Mitogen-activated protein kinase 3 antibody produced in rabbit, Anti-p44-ERK1 antibody produced in rabbit, Anti-p44-MAPK antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

제품명

Anti-MAPK3 antibody produced in rabbit, Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

rat, human, mouse

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYI

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MAPK3(5595)

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

Mitogen-activated protein kinase 3 (MAPK3) is a member of the MAP kinase family and is involved in various cell signalling pathways.

면역원

Mitogen-activated protein kinase 3 recombinant protein epitope signature tag (PrEST)

애플리케이션

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

Mitogen-activated protein kinase 3 (MAPK3) is involved actively in signaling modules through which cells transduce extracellular signals into intracellular responses. The different pathways have been associated with the regulation of cellular proliferation, differentiation, angiogenesis, embryo development and tumor invasion. In the Ras/extracellular signal-regulated kinase (ERK) pathway, the p90 ribosomal S6 kinases (RSKs) lie at the terminus of the ERK pathway. RSK activation by ERK requires its interaction through a docking site located near the C terminus of RSK. They form a complex which is further involved in activating and recruiting other proteins downstream for the pathway. In another pathway dealing with cell proliferation and differentiation, Raf phosphorylates and activates MEK1/2, which phosphorylates MAPK3 on Thr183 and Tyr185 in the activation loop resulting in full activation of MAPK3. Phosphorylation and de-phosphorylation of MAPK3 provides a rapid and reversible regulatory system to control its activity.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86538

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Zhimin Lu et al.
Molecular cell, 9(5), 945-956 (2002-06-07)
ERK1/2 MAP kinases are important regulators in cellular signaling, whose activity is normally reversibly regulated by threonine-tyrosine phosphorylation. In contrast, we have found that stress-induced ERK1/2 activity is downregulated by ubiquitin/proteasome-mediated degradation of ERK1/2. The PHD domain of MEKK1, a
Philippe P Roux et al.
Molecular and cellular biology, 23(14), 4796-4804 (2003-07-02)
Stimulation of the Ras/extracellular signal-regulated kinase (ERK) pathway can modulate cell growth, proliferation, survival, and motility. The p90 ribosomal S6 kinases (RSKs) comprise a family of serine/threonine kinases that lie at the terminus of the ERK pathway. Efficient RSK activation
M P Fatt et al.
Cell death and differentiation, 21(10), 1546-1559 (2014-05-09)
The p53 family members p73 and p63 have been implicated in various aspects of stem cell regulation. Here, we have asked whether they work together to regulate stem cell biology, focusing upon neural precursor cells (NPCs) in the adult murine
Haizhong Feng et al.
The Journal of clinical investigation, 124(9), 3741-3756 (2014-07-26)
Aberrant activation of EGFR in human cancers promotes tumorigenesis through stimulation of AKT signaling. Here, we determined that the discoidina neuropilin-like membrane protein DCBLD2 is upregulated in clinical specimens of glioblastomas and head and neck cancers (HNCs) and is required
Ning Chai et al.
Neuropsychopharmacology : official publication of the American College of Neuropsychopharmacology, 39(8), 1933-1945 (2014-02-21)
Fear extinction has been extensively studied, but little is known about the molecular processes that underlie the persistence of extinction long-term memory (LTM). We found that microinfusion of norepinephrine (NE) into the CA1 area of the dorsal hippocampus during the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.