생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
47 kDa
종 반응성
horse, dog, mouse, rat, human, pig, rabbit
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... GFRA2(2675)
면역원
Synthetic peptide directed towards the C terminal region of human GFRA2
애플리케이션
Anti-GFRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
GFRA2 are cell surface bound glycoproteins that mediate interactions of the glial-cell-line-derived neurotrophic factor (GDNF) ligand family with the RET receptor that are crucial for the development of kidney and some peripheral nerve lineages. GFRA2 gene is shown to be associated with tardive dyskinesia in a study. The factors GDNF and neurturin, along with their receptors GFRA1 and GFRA2, respectively, are crucial for enteric neuron survival in human colon. The gene is shown to be associated with schizophrenia and clozapine response in a study. It is associated with severe abdominal pain sensation in pancreatic cancer patients.
서열
Synthetic peptide located within the following region: NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
M Barrenschee et al.
Cell and tissue research, 354(2), 371-380 (2013-07-25)
Two of the glial-cell-line-derived neurotrophic factor (GDNF) family ligands (GFLs), namely GDNF and neurturin (NRTN), are essential neurotropic factors for enteric nerve cells. Signal transduction is mediated by a receptor complex composed of GDNF family receptor alpha 1 (GFRα1) for
J B Vanhorne et al.
Human genetics, 108(5), 409-415 (2001-06-21)
The glial-cell-line-derived neurotrophic factor (GDNF) family receptors alpha (GFRalpha) are cell surface bound glycoproteins that mediate interactions of the GDNF ligand family with the RET receptor. These interactions are crucial to the development of the kidney and some peripheral nerve
Renan P Souza et al.
Journal of psychiatric research, 44(11), 700-706 (2010-02-02)
GDNF (glial-cell-line derived neurotrophic factor) is a potent neurotrophic factor for dopaminergic neurons. Neuropsychiatric diseases and their treatments are associated with alterations in the levels of both GDNF and its receptor family (GDNF family receptor alpha or GFRA). GFRA1, GFRA2
Renan P Souza et al.
Psychopharmacology, 210(3), 347-354 (2010-04-07)
Tardive dyskinesia (TD) has a pharmacogenetic component in which the interaction of antipsychotic exposure with individual genetic variation mediates risk. The glial cell line-derived neurotrophic factor (GDNF) signalling pathway has been associated with neuroprotective effects in central dopaminergic neurons and
Kun Wang et al.
Carcinogenesis, 35(1), 103-113 (2013-09-27)
Neurotrophic factors possess an emerging role in the pathophysiology of several gastrointestinal disorders, regulating innervation, pain sensation and disease-associated neuroplasticity. Here, we aimed at characterizing the role of the neurotrophic factor neurturin (NRTN) and its receptor glial-cell-line-derived neurotrophic factor receptor
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.