콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV54286

Sigma-Aldrich

Anti-EPHX1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-EPHX, Anti-EPOX, Anti-Eoxide hydrolase 1, microsomal (xenobiotic), Anti-MEH

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

53 kDa

종 반응성

horse, goat, guinea pig, rat, human, mouse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... EPHX1(2052)

면역원

Synthetic peptide directed towards the middle region of human EPHX1

애플리케이션

Anti-EPHX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

EPHX1 [Epoxide hydrolase 1, microsomal (xenobiotic)] gene encodes a biotransformation enzyme that metabolizes arene and aliphatic epoxides to more water-soluble trans-dihydrodiol derivatives. It also plays a pivotal role in carcinogen metabolism and facilitates the sodium-dependent uptake of bile acids into hepatocytes. Mutation in EPHX1 gene results in preeclampsia, which causes increased epoxide hydrolase activity or epoxide hydrolase deficiency.

서열

Synthetic peptide located within the following region: CPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLI

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

J Lundbom et al.
Scandinavian journal of thoracic and cardiovascular surgery, 26(3), 187-192 (1992-01-01)
Factors influencing the effect on employment status were investigated in 250 patients (males: females 224:26) who underwent coronary artery bypass surgery between March 1983 and November 1985. The median age at operation was 57.9 (range 36.6-69.4) years and the median
Jaana Laasanen et al.
European journal of human genetics : EJHG, 10(9), 569-573 (2002-08-13)
This study determined whether genetic variability in exons 3 and 4 of the microsomal epoxide hydrolase gene jointly modifies individual preeclampsia risk. The study also determined whether genetic variability in the gene encoding for microsomal epoxide hydrolase (EPHX) contributes to
C Hassett et al.
Human molecular genetics, 3(3), 421-428 (1994-03-01)
Human microsomal epoxide hydrolase (mEH) is a biotransformation enzyme that metabolizes reactive epoxide intermediates to more water-soluble trans-dihydrodiol derivatives. We compared protein-coding sequences from six full-length human mEH DNA clones and assessed potential amino acid variation at seven positions. The

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.