추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
98 kDa
종 반응성
horse, human, mouse, rabbit, dog, rat
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... LPIN1(23175)
면역원
Synthetic peptide directed towards the N terminal region of human LPIN1
애플리케이션
Anti-LPIN1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
생화학적/생리학적 작용
LPIN1 (lipin 1) encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. It is a transcriptional co-regulator that regulates lipid metabolism and adipogenesis (adipocyte maturation and maintenance) by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and PPAR γ (peroxisome-proliferator-activated receptor γ) network. Lipin 1 also plays a pivotal role in controlling autophagy clearance by facilitating the maturation of autolysosomes via stimulation of protein kinase D (PKD)-Vps34 phosphatidylinositol 3-kinase signaling cascade.
서열
Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Peixiang Zhang et al.
Cell metabolism, 20(2), 267-279 (2014-06-17)
LPIN1 encodes lipin-1, a phosphatidic acid phosphatase (PAP) enzyme that catalyzes the dephosphorylation of phosphatidic acid to form diacylglycerol. Homozygous LPIN1 gene mutations cause severe rhabdomyolysis, and heterozygous LPIN1 missense mutations may promote statin-induced myopathy. We demonstrate that lipin-1-related myopathy
Hee Eun Kim et al.
The Biochemical journal, 453(1), 49-60 (2013-05-01)
PPARγ (peroxisome-proliferator-activated receptor γ) is a master transcription factor involved in adipogenesis through regulating adipocyte-specific gene expression. Recently, lipin1 was found to act as a key factor for adipocyte maturation and maintenance by modulating the C/EBPα (CCAAT/enhancer-binding protein α) and
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.