콘텐츠로 건너뛰기
Merck
모든 사진(2)

Key Documents

AV53693

Sigma-Aldrich

Anti-HSPA4L antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-APG-1, Anti-Heat shock 70 kDa protein 4-like, Anti-Osp94

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

95 kDa

종 반응성

human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... HSPA4L(22824)

일반 설명

Heat shock 70kDa protein 4L is a protein encoded by the HSPA4L gene in humans. Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones.

면역원

Synthetic peptide directed towards the C terminal region of human HSPA4L

애플리케이션

Anti-HSPA4L antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/mL.

생화학적/생리학적 작용

Hspa4l is expressed ubiquitously and predominantly in the testis and is highly expressed in spermatogenic cells. It plays an important role in osmotolerance. HSPA4L and HSPA4 collaborate in embryonic lung maturation and helps in air breathing during child birth. Osp94 also acts as molecular chaperone and possesses cytoprotective role from excessive stimulation from heat, hyper-ionic and osmotic stress which cause marked perturbation of intracellular protein function including the suppression of protein synthesis.

서열

Synthetic peptide located within the following region: KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Belal A Mohamed et al.
American journal of respiratory cell and molecular biology, 50(4), 817-824 (2013-08-29)
Heat shock proteins HSPA4L and HSPA4 are closely related members of the HSP110 family and act as cochaperones. We generated Hspa4l(-/-)Hspa4(-/-) mice to investigate a functional complementarity between HSPA4L and HSPA4 during embryonic development. Hspa4l(-/-)Hspa4(-/-) embryos exhibited marked pulmonary hypoplasia
H Yamamoto et al.
Neuroscience, 158(4), 1691-1698 (2008-12-09)
Osmotic stress protein 94 (OSP94), a member of the heat shock protein 110/SSE subfamily, is expressed in certain organs such as the kidney, testis, and brain where it can act as a molecular chaperon. In general, its alteration in expression
Torsten Held et al.
Molecular and cellular biology, 26(21), 8099-8108 (2006-08-23)
The Hspa4l gene, also known as Apg1 or Osp94, belongs to the HSP110 heat shock gene family, which includes three genes encoding highly conserved proteins. This study shows that Hspa4l is expressed ubiquitously and predominantly in the testis. The protein

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.