AV52288

Anti-NUP50 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-MGC39961, Anti-NPAP60, Anti-NPAP60L, Anti-Nucleoporin 50 kDa
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: IF; WB
• 클론: polyclonal
• 종 반응성: pig, rabbit, dog, horse, human, bovine
• 기술: immunofluorescence: suitable; western blot: suitable

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 50 kDa
• 종 반응성: pig, rabbit, dog, horse, human, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunofluorescence: suitable; western blot: suitable
• NCBI 수납 번호: NP_705931
• UniProt 수납 번호: Q9UKX7
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NUP50(10762)

설명

면역원

Synthetic peptide directed towards the C terminal region of human NUP50

생화학적/생리학적 작용

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.

서열

Synthetic peptide located within the following region: TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable