콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV51287

Sigma-Aldrich

Anti-TNNT3 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-AMCD2B, Anti-DA2B, Anti-DKFZp779M2348, Anti-FSSV, Anti-Troponin T type 3 (skeletal, fast)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

30 kDa

종 반응성

rabbit, bovine, horse, mouse, rat, dog, goat, human, guinea pig

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TNNT3(7140)

면역원

Synthetic peptide directed towards the N terminal region of human TNNT3

애플리케이션

Anti-TNNT3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

생화학적/생리학적 작용

Troponin T type 3 (TNNT3) is a fast-twitch muscle protein belonging to the troponin T gene family. It forms a complex that regulates striated muscle contraction along with troponins C and I. Two isoforms of TNNT3 are present, the fetal/neonatal and the adult isoforms and a developmental switch of the isoforms occurs. Mutations in TNNT3 have been identified in distal arthrogryposis multiplex congenita type 2B and Sheldon-Hall syndrome.

서열

Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ning Zhao et al.
European journal of medical genetics, 54(3), 351-353 (2011-03-16)
Distal arthrogryposis (DA) is a group of rare, clinically and genetically heterogeneous disorders primarily characterized by congenital contractures of the limb joints. Recently, mutations in genes encoding the fast-twitch skeletal muscle contractile myofibers complex, including troponin I2 (TNNI2), troponin T3
Raymund Stefancsik et al.
Comparative and functional genomics, 4(6), 609-625 (2008-07-17)
We describe the cloning, sequencing and structure of the human fast skeletal troponin T (TNNT3) gene located on chromosome 11p15.5. The single-copy gene encodes 19 exons and 18 introns. Eleven of these exons, 1-3, 9-15 and 18, are constitutively spliced
P A Krakowiak et al.
American journal of medical genetics, 76(1), 93-98 (1998-03-21)
We describe the clinical characteristics of a provisionally unique form of distal arthrogryposis. The anomalies observed in affected individuals are more severe than those in distal arthrogryposis type 1 and are similar to but less dramatic than those described in
Tathagata Chaudhuri et al.
Journal of molecular biology, 352(1), 58-71 (2005-08-06)
In mammalian fast skeletal muscle, constitutive and alternative splicing from a single troponin T (TnT) gene produce multiple developmentally regulated and tissue specific TnT isoforms. Two exons, alpha (exon 16) and beta (exon 17), located near the 3' end of

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.