추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
99 kDa
종 반응성
mouse, rat, dog, pig, bovine, horse, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... POLK(51426)
관련 카테고리
일반 설명
POLK codes for polymerase (DNA directed) κ that facilitates DNA-damage bypass via the extension step of lesion bypass. POLK promoter is negatively regulated by p53.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.
Rabbit Anti-POLK antibody recognizes human, mouse, rat, canine, and bovine POLK.
면역원
Synthetic peptide directed towards the middle region of human POLK
애플리케이션
Rabbit Anti-POLK antibody is suitable for western blot applications at a concentration of 1μg/ml.
생화학적/생리학적 작용
POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Depending on the context, it inserts the correct base, but causes frequent base transitions, transversions and frameshifts. It lacks 3′-5′ proofreading exonuclease activity. POLK forms a Schiff base with 5′-deoxyribose phosphate at abasic sites, but does not have lyase activity.
서열
Synthetic peptide located within the following region: ATECTLEKTDKDKFVKPLEMSHKKSFFDKKRSERKWSHQDTFKCEAVNKQ
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Yanqing Wang et al.
International journal of oncology, 25(1), 161-165 (2004-06-18)
DNA polymerase kappa (POLkappa) is a low fidelity translesional DNA polymerase implicated in spontaneous and DNA damage-induced mutagenesis. We have previously shown that POLkappa was frequently overexpressed in human lung cancer tissues as compared with their matched non-tumorous tissue counterpart.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.