추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
36 kDa
종 반응성
pig, mouse, rat, dog, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... AKR1B1(231)
일반 설명
AKR1B1 codes for a aldo/keto reductase superfamily that catalyzes the reduction of aldehydes. It may functions as PGF synthase in pig endometrium during early pregnancy. AKR1B1 can be induced by proteasome inhibitors in human colon cancer cells. Polymoprhisma in AKR1B1 have been linked to renal insufficiency in type 2 diabetics.
Rabbit Anti-AKR1B1 antibody recognizes chicken, canine, rabbit, human, mouse, rat, bovine, pig, and zebrafish AKR1B1.
Rabbit Anti-AKR1B1 antibody recognizes chicken, canine, rabbit, human, mouse, rat, bovine, pig, and zebrafish AKR1B1.
면역원
Synthetic peptide directed towards the C terminal region of human AKR1B1
애플리케이션
Rabbit Anti-AKR1B1 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.
생화학적/생리학적 작용
AKR1B1 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. There are a few putative pseudogenes for this gene, and one of them has been confirmed and mapped to chromosome 3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
서열
Synthetic peptide located within the following region: QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Heewon Seo et al.
Biology of reproduction, 90(5), 99-99 (2014-04-04)
Prostaglandins (PGs) are important lipid mediators regulating various reproductive processes in many species. In pigs, the expression pattern of PGE2 and PGF2α metabolic enzymes and the regulatory mechanism controlling PGE2 and PGF2α levels in the uterus during pregnancy are not
Nadeeya Mad-Adam et al.
Oncology letters, 23(2), 59-59 (2022-01-08)
Ovarian cancer ranks eighth in cancer incidence and mortality among women worldwide. Cisplatin-based chemotherapy is commonly used for patients with ovarian cancer. However, the clinical efficacy of cisplatin is limited due to the occurrence of adverse side effects and development
Adam J Ziecik et al.
Biology of reproduction, 103(5), 1069-1084 (2020-08-04)
Altrenogest with gonadotropins is commonly used to synchronize the estrous cycle, but it can also lead to follicular cyst formation, especially in prepubertal gilts. Here, we aimed to investigate how maturity and altrenogest treatment affect the development, endocrine milieu, and
Pushplata Prasad et al.
BMC medical genetics, 11, 52-52 (2010-04-01)
To determine association of nine single nucleotide polymorphisms (SNPs) in ADP ribosyltransferase-1 (ADPRT1), aldo-keto reductase family 1 member B1 (AKR1B1), receptor for advanced glycation end-products (RAGE), glutamine:fructose-6-phosphate amidotransferase-2 (GFPT2), and plasminogen activator inhibitor-1 (PAI-1) genes with chronic renal insufficiency (CRI)
Bettina Ebert et al.
Chemico-biological interactions, 191(1-3), 239-249 (2011-01-11)
Aldo-keto reductases (AKRs) play central roles in the reductive metabolism of endogenous signaling molecules and in the detoxification of xenobiotics. AKRC1-1C3, AKR1B1 and AKR1B10 have been shown to be regulated via nuclear factor-erythroid 2 related factor 2 (Nrf2), a transcription
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.