AV47057

Anti-LAPTM4A antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-KIAA0108, Anti-LAPTM4, Anti-Lysosomal-associated protein transmembrane 4 α, Anti-MBNT, Anti-Mtrp
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 27 kDa
• 종 반응성: horse, rabbit, guinea pig, dog, bovine, human, rat, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_055528
• UniProt 수납 번호: Q15012
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LAPTM4A(9741)

설명

일반 설명

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

면역원

Synthetic peptide directed towards the middle region of human LAPTM4A

애플리케이션

Anti-LAPTM4A antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL.

생화학적/생리학적 작용

LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.This gene encodes a protein that has four predicted transmembrane domains. The function of this gene has not yet been determined; however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

서열

Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable