콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV42553

Sigma-Aldrich

Anti-AKR1B10 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-AKR1B11, Anti-AKR1B12, Anti-ALDRLn, Anti-ARL-1, Anti-ARL1, Anti-Aldo-keto reductase family 1, member B10 (aldose reductase), Anti-HIS, Anti-HSI

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

35 kDa

종 반응성

rabbit, human, dog, yeast, horse, mouse

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... AKR1B10(57016)

일반 설명

Aldo-keto reductase family 1B10 (AKR1B10) exhibits restricted lipid substrate specificity including farnesal, geranylgeranial, retinal and carbonyls; wherein metabolizing these lipid substrates has a crucial role in promoting carcinogenesis. AKR1B10 and 1B12 display high catalytic efficiency with all-trans-retinaldehyde. Aldo-keto reductase 1B10 (AKR1B10) is a secretory protein that is upregulated with tumorigenic transformation of human mammary epithelial cells. It is a tumor marker for cancers such as pancreatic cancer, lung carcinomas.

특이성

Anti-AKR1B10 polyclonal antibody reacts with human, mouse, rat, and zebrafish aldo-keto reductase family 1, member B10 (aldose reductase) enzymes..

면역원

Synthetic peptide directed towards the N terminal region of human AKR1B10

애플리케이션

Anti-AKR1B10 polyclonal antibody is used to tag advanced AKR1B10 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a potential tumor marker for pancreatic and lung cancer.

생화학적/생리학적 작용

AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

서열

Synthetic peptide located within the following region: NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our 문서 section.

도움이 필요하시면 연락하세요. 고객 지원 부서

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.