AV40647

Anti-RNASEH2A antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Ribonuclease H2, subunit A
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 결합: unconjugated
• application: IHC; WB
• 클론: polyclonal
• 종 반응성: goat, human, pig, bovine, horse
• citations: 1
• 기술: immunohistochemistry: suitable; western blot: suitable

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 33 kDa
• 종 반응성: goat, human, pig, bovine, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006388
• UniProt 수납 번호: O75792
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RNASEH2A(10535)

설명

면역원

Synthetic peptide directed towards the middle region of human RNASEH2A

생화학적/생리학적 작용

Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.Of the multiple RNases H in mammals, RNase HI is the major enzyme and shows increased activity during DNA replication. It shows more homology to the RNase HII of Escherichia coli.

서열

Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable