콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV41929

Sigma-Aldrich

Anti-CD40 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Bp50, Anti-CD40 molecule, TNF receptor superfamily member 5, Anti-CDW40, Anti-MGC9013, Anti-TNFRSF5, Anti-p50

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

30 kDa

종 반응성

human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CD40(958)

일반 설명

CD40 ligand, a membrane glycoprotein, is a member of the TNF family. It is predominantly expressed on activated CD4+ T cells, as well as on other cell types. The receptor to CD40 ligand is CD40. The binding of CD40 and CD40 ligand mediates B cell, monocyte, and dendritic cell activities. CD40 (BP50), a 48 kDa type I single chain transmembrane glycoprotein expressed on normal and neoplastic B cells, but not on terminally differentiated plasma cells. CD40 antigen is also present on Hodgkin′s and Reed-Sternberg cells, follicular dendritic cells, some macrophages, basal epithelial cells and endothelial cells.

특이성

Anti-CD40 polyclonal antibody reacts with human CD40 molecule.

면역원

Synthetic peptide directed towards the N terminal region of human CD40

애플리케이션

Anti-CD40 polyclonal antibody is used to tag CD40 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CD40 in cell signaling within T-cells, dendritic cells, macrophages, epithelial and endothelial cells.

생화학적/생리학적 작용

CD40 is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis.The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

서열

Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Menno C van Zelm et al.
The Journal of allergy and clinical immunology, 134(1), 135-144 (2014-01-15)
Individuals with genetic defects in CD40 ligand (CD40L) or B-cell antigen receptor coreceptor molecules CD19 and CD81 suffer from an antibody deficiency. Still, these patients carry low levels of memory B cells and serum antibodies. We sought to assess why
Mala Upadhyay et al.
Journal of cellular physiology, 229(10), 1387-1396 (2014-02-01)
Immunological memory comprising of antigen-specific B and T cells contributes to the acquisition of long-term resistance to pathogens. Interactions between CD40 on B cells and CD40L on T cells are responsible for several aspects of acquired immune responses including generation
Bikui Zhang et al.
Neuroscience letters, 567, 6-10 (2014-03-25)
Post-stroke epilepsy (PSE) has a negative effect on stroke prognosis and quality of life. The CD40/CD40L system is reported to be involved in the progression of multiple disease states. We investigated the association between functional polymorphism of CD40 and PSE
Katsuyuki Horiuchi et al.
The Journal of allergy and clinical immunology, 134(2), 411-419 (2014-05-20)
The molecular mechanism of class-switch recombination (CSR) in human subjects has not been fully elucidated. The CSR-induced mutations occurring in the switch region of the IgM gene (Smu-SHMs) in in vitro CSR-activated and in vivo switched B cells have been
Jingjuan Meng et al.
International journal of biological macromolecules, 69, 388-392 (2014-06-20)
The seaweed Laminaria japonica has been investigated in a laboratory research for its medical significance and LJP has been purified now. The objective of present study was to look at effect of LJP on structural, phenotypic and functional maturation of

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.