AV40475

Anti-PRKRA antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Protein kinase, interferon-inducible double stranded RNA-dependent activator
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 34 kDa
• 종 반응성: guinea pig, human, rat, rabbit, horse, mouse, dog, bovine
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_001132989
• UniProt 수납 번호: O75569
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRKRA(8575)

설명

일반 설명

Protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase (PRKRA, PACT) is a stress-modulated cellular activator of interferon (IFN)-induced double-stranded (ds) RNA-activated protein kinase (PKR) which is involved in antiviral defense in mammals. PACT and Mammalian Dicer interacts with double-stranded RNA-binding protein (TRBP) and associate with Dicer to stimulate cleavage of double-stranded RNA found in short hairpin and short interfering RNA (siRNA).

특이성

Anti-PRKRA polyclonal antibody reacts with bovine, canine, human, mouse, and rat protein kinase, interferon-inducible double stranded RNA-dependent activators/protein activator of the interferon-induced protein kinases.

면역원

Synthetic peptide directed towards the middle region of human PRKRA

애플리케이션

Anti-PRKRA polyclonal antibody is used to tag protein kinase, interferon-inducible double stranded RNA-dependent activator/protein activator of the interferon-induced protein kinase for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of protein activator of the interferon-induced protein kinase (PACT) in stress response, antiviral activity and double-stranded RNA processing.

생화학적/생리학적 작용

PRKRA contains 3 DRBM (double-stranded RNA-binding) domains. It appears to have a pro-apoptotic function that may be suppressed in the presence of growth factor and activates EIF2AK2 in absence of double stranded RNA (dsRNA).

서열

Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable