AV40225

Anti-EXOSC10 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Exosome component 10
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 97 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_002676
• UniProt 수납 번호: Q01780
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... EXOSC10(5394)

설명

일반 설명

Exosome complex (RNAse complex), a complex of 3′ -→ 5′ exoribonucleases, is a multi-protein complex that degrades various types of ribonucleic acids (RNA). Exosome component 10 (EXOSC10, PMSCL2, "polymyositis/scleroderma autoantigen 2, 100kDa) is an exoribonuclease that shares sequence similarity to budding yeast Rrp6 and is proposed to catalyze 3′-to-5′ exoribonuclease activity on a variety of nuclear transcripts including ribosomal RNA subunits, RNA that has been poly-adenylated by TRAMP, as well as other nuclear RNA transcripts destined for processing and/or destruction.

특이성

Anti-EXOSC10 polyclonal antibody reacts with human, mouse, rat, and bovine polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) proteins.

면역원

Synthetic peptide directed towards the C terminal region of human EXOSC10

애플리케이션

Anti-EXOSC10 polyclonal antibody is used to tag polymyositis/scleroderma autoantigen 2, 100kDa for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) in the function of specific exosomes.

생화학적/생리학적 작용

EXOSC10 contains 1 HRDC domain and 1 3′-5′ exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

서열

Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable